PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 285aa    MW: 31632.1 Da    PI: 6.572
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.4e-343387155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt++LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl+h+kSHLQkYRl
  XP_012570032.1 33 KPRLRWTTDLHQRFVDAVTQLGGATKATPKAIMRTMNVKGLTLYHLKSHLQKYRL 87
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-333088IPR009057Homeodomain-like
PROSITE profilePS5129410.1533090IPR017930Myb domain
TIGRFAMsTIGR015575.4E-243388IPR006447Myb domain, plants
SuperFamilySSF466891.33E-163388IPR009057Homeodomain-like
PfamPF002496.2E-83586IPR001005SANT/Myb domain
PfamPF143793.4E-13131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MFSRLIQHEG SVVSEDIHNH LADPCLVLTS DPKPRLRWTT DLHQRFVDAV TQLGGATKAT  60
PKAIMRTMNV KGLTLYHLKS HLQKYRLGKQ AGKDSEEGCK DGMSGSYLLE SPGTEHSSPK  120
LPVSDANEGH EVKEALRAQM EVQSKLHLLV EAEKHLQIRQ DAERRYMAML ERACKMLADQ  180
FIGDTITDTD IQKFEEVPSS EIGGMHVSEI PYILQPQGAN CSTESCLTSL ESLRGLTLEG  240
SPGGTKRMLG LDSMVAPLFW TETNIRTHGI HLAQVNPEGI TRYGM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0951071e-158BT095107.1 Soybean clone JCVI-FLGm-19M17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012570032.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK53e-44APL_ARATH; Myb family transcription factor APL
TrEMBLA0A072VPG60.0A0A072VPG6_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA10G34050.31e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.19e-63G2-like family protein